PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G1585
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 359aa    MW: 41220.8 Da    PI: 5.8837
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G1585genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.43.9e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g+W+t ++  g+ R++k+c++rw +yl
      Gh_D05G1585 14 KGPWTPEEDQKLIDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.52.7e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
      Gh_D05G1585  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-27564IPR009057Homeodomain-like
PROSITE profilePS5129425.649965IPR017930Myb domain
SuperFamilySSF466892.85E-3211108IPR009057Homeodomain-like
SMARTSM007174.9E-141363IPR001005SANT/Myb domain
PfamPF002493.7E-171461IPR001005SANT/Myb domain
CDDcd001675.46E-131661No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129420.4666116IPR017930Myb domain
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1567111IPR001005SANT/Myb domain
CDDcd001673.51E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGRSPCCDKN GLKKGPWTPE EDQKLIDYIQ KHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDLSSILS SSLYNQSQMN ISRLLCVNSL VNPELLRLAT SFMSSQRENQ  180
NHEFIVDHNV EDNQLCSSQV QDQYQQPLMQ SNHNHLPTQV QEIPACSIPF SNEAELMNMD  240
QFPSNFSHLN DWQSNAMPSD LTEDYVPLPP NYDYYATDHH HHQTVKDPSS SETSNFQSNN  300
SNQSFSFASV LSTPSSSPTQ LNSNSTYVNN SGIEEEPDSY CSNILKFEIR DVLDVNDFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-31121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.91501e-58ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6159100.0JX615910.1 Gossypium hirsutum clone NBRI_GE60185 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448162.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0D2S3090.0A0A0D2S309_G
STRINGVIT_00s0203g00070.t011e-163(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-114MYB-like 102